RGAP LOCUS ID | LOC_Os03g18550 | ||||
RAP-DB ID | Os03g0296800 | ||||
Function | mitochondrial carrier protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | cyto | ||||
score | 8 | ||||
2) CELLO Prediction |
|||||
localization | PlasmaMembrane | ||||
score | 1.224 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.08 | ||||
4) Y-Loc Prediction |
|||||
localization | Cytoplasm | ||||
score | 71 | ||||
confidence value | 0.33 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | MIT | ||||
Function assigned as per literature | MIT is a mitochondrial Fe transporter essential for rice growth and development | ||||
Subcellular localization as per literature | Mitochondria | ||||
Cells used for localization experiment | Tobacco BY-2 cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 21610725 | ||||
Reference of localization | https://www.nature.com/articles/ncomms1326 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.101 | ||||
NLS score | -0.16 | ||||
Protein Sequence | >LOC_Os03g18550.1 protein MAADYRTPDRLLSAAAPGEEQAQDPPKPVLAVAATHDGLRFWQYMLAGSVAGVVEHTAMFPVDTLKTHMQAGAPPCRPVLSLGAVLRAAVSGEGGVRALY RGLPAMALGAGPAHAVYFSVYEFAKSRLSERLGPNNPAAHAASGVLATIASDAVFTPMDTVKQRLQLTSSPYTGVSHCVRTVLRDEGLGAFFASYRTTVV MNAPYTAVHFATYEAAKRMLGDMATNEDSLAVHATAGAAAGALAAAVTTPLDVVKTQLQCQGVCGCERFSSSSIGDVFRTIIKRDGYAGLMRGWKPRMLF HAPAAAICWSTYEASKSFFERFNEKRRK |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | YES |