RGAP LOCUS ID | LOC_Os03g16030 | ||||
RAP-DB ID | Os03g0267000 | ||||
Function | hsp20/alpha crystallin family protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | cyto | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Cytoplasmic | ||||
score | 3.777 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.05 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 5 | ||||
confidence value | 0.1 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsHsp18.0-CI|Oshsp18.0|OsMSR3 | ||||
Function assigned as per literature | OsHsp18.0 is a positive regulator in both biotic and abiotic defense responses | ||||
Subcellular localization as per literature | Cytoplasm and nuclear envelope | ||||
Cells used for localization experiment | Nicotiana benthamiana leaf cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 28900229 | ||||
Reference of localization | https://www.nature.com/articles/s41598-017-11882-x | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.161 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os03g16030.1 protein MSLIRRSNVFDPFSLDLWDPFDGFPFGSGSRSSGSIFPSFPRGTSSETAAFAGARIDWKETPEAHVFKADVPGLKKEEVKVEVEDGNVLQISGERSKEQE EKTDKWHRVERSSGKFLRRFRLPENTKPEQIKASMENGVLTVTVPKEEPKKPDVKSIQVTG |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
Presence of Splice variants | No |