RGAP LOCUS ID | LOC_Os03g11100 | ||||
RAP-DB ID | Os03g0209400 | ||||
Function | vesicle transport protein GOT1B, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | plas | ||||
score | 4 | ||||
2) CELLO Prediction |
|||||
localization | PlasmaMembrane | ||||
score | 4.387 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.01 | ||||
4) Y-Loc Prediction |
|||||
localization | Secreted pathw | ||||
score | |||||
confidence value | 0.83 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | GOT1B|GLUP2 | ||||
Function assigned as per literature | GOT1B plays an important role in mediating COPII vesicle formation at ERESs, thus facilitating anterograde transport of secretory proteins in plant cells. | ||||
Subcellular localization as per literature | ERESs | ||||
Cells used for localization experiment | N. benthamiana leaf epidermal cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 27803308 | ||||
Reference of localization | http://www.plantcell.org/content/plantcell/early/2016/11/01/tpc.16.00717.full.pdf | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.086 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os03g11100.1 protein MVSFEMNDLKKIGLGLTGFGVFFSFLGIIFFFDKGLIAMGNILFLSGLGLTIGLKSTMQFFTKPKNYKGTISFGAGFFLVLIGWPFFGMLLEAYGFVVLF SGFWPTLVVFLQRIPIIGWIFQQPFVTSFLDRYRGKRVPV |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |