LOC_Os03g08310
| RGAP LOCUS ID | LOC_Os03g08310 |
| RAP-DB ID | Os03g0180800 |
| Function | ZIM domain containing protein, putative, expressed |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | chlo |
| score | 5 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 1.106 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.25 |
4) Y-Loc Prediction |
|
| localization | Chloroplast |
| score | 4 |
| confidence value | 0.13 |
| Number Of Software Predicting Nucleus | 1 |
| Seed Specific | No |
| Transcription factor category | Tify |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsJAZ9|OsTIFY11a |
| Function assigned as per literature | OsTIFY11a play important roles in response to abiotic stresses |
| Subcellular localization as per literature | Nucleus |
| Cells used for localization experiment | Arabidopsis mesophyll protoplasts |
| NUCLEAR or Not Nuclear | NUCLEAR |
| PMID | 19618278 |
| Reference of localization | https://link.springer.com/article/10.1007%2Fs11103-009-9524-8 |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 2 |
| Number of Bipartite | 0 |
| Basic residues % | 0.117 |
| NLS score | 0.13 |
| Protein Sequence | >LOC_Os03g08310.1 protein MASTDPMTRRFAVACGVLSQYVKANSSQPSTAAPVAQGVSGLMAAAAAAAAAPVVQEPGCEVDGGGQQFTIFYAGKVVVIDRCTPAMAAELMRFASAAQG GGGAPEAPPALVDMPIARKASLKRFLAKRKATPASARSSYVVRAAAAEEEQPPAKKAKAAVERREDWLALGSLGHMHSR |
GO Analysis |
|
| Presence of Splice variants | No |