LOC_Os03g01740
| RGAP LOCUS ID | LOC_Os03g01740 |
| RAP-DB ID | Os03g0107700 |
| Function | expressed protein |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | chlo |
| score | 9 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 3.815 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.42 |
4) Y-Loc Prediction |
|
| localization | Chloroplast |
| score | 9 |
| confidence value | 0.29 |
| Number Of Software Predicting Nucleus | 1 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | Orysa;EL2 |
| Function assigned as per literature | Orysa;EL2 might coordinate stress perception and cell cycle progression |
| Subcellular localization as per literature | Nucleus |
| Cells used for localization experiment | Onion epidermal cells |
| NUCLEAR or Not Nuclear | NUCLEAR |
| PMID | 17599908 |
| Reference of localization | http://www.jbc.org/content/282/35/25588.long#F3 |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 1 |
| Number of PAT7 | 2 |
| Number of Bipartite | 0 |
| Basic residues % | 0.132 |
| NLS score | 0.47 |
| Protein Sequence | >LOC_Os03g01740.1 protein MSASPEFYRPSPPAFSPSCAAGTSTTEVDEYSCCRTPTPGIREPATCPPAPRKPRPVACRKLLFDPAQQQGKGKAISLRLDELERLFRPITNNANLHLQT NKPTHT |
GO Analysis |
|
| Presence of Splice variants | No |