LOC_Os02g57280
| RGAP LOCUS ID | LOC_Os02g57280 |
| RAP-DB ID | Os02g0818000 |
| Function | CBS domain containing membrane protein, putative, expressed |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | chlo |
| score | 13 |
2) CELLO Prediction |
|
| localization | Chloroplast |
| score | 2.539 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.1 |
4) Y-Loc Prediction |
|
| localization | Cytoplasm |
| score | 95 |
| confidence value | 0.77 |
| Number Of Software Predicting Nucleus | 0 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsCBSX3 |
| Function assigned as per literature | OsCBSX3 acts as a positive regulator in resistance of rice to M. oryzae regulated by SA and JA-mediated signaling pathways synergistically |
| Subcellular localization as per literature | plasma membrane |
| Cells used for localization experiment | Nicotiana benthamiana leaves |
| NUCLEAR or Not Nuclear | NOT NUCLEAR |
| PMID | 26184180 |
| Reference of localization | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4519930/pdf/ijms-16-15903.pdf |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.108 |
| NLS score | -0.47 |
| Protein Sequence | >LOC_Os02g57280.1 protein MACINTFQSCSVLKGAKINGTKIGGGRGSPTFRCRASTFMDGSLRLEIDENPEAIISGEWPENFSLLSYDDLRAYLQSQEAAAQADNQRVALLSEAMSAP VLVATAEQTLEEVECHFETVSGLPVIDASLRCVGVIVKSDRARASHGSKTKIAEVMTSPAITLPSDKTVMDAAALMLKKKIHRLPIVNQDRQVIGIVTRA DVLRELEALLEV |
GO Analysis |
|
| Presence of Splice variants | YES |