RGAP LOCUS ID | LOC_Os02g57250 | ||||
RAP-DB ID | Os02g0817600 | ||||
Function | OsIAA10 - Auxin-responsive Aux/IAA gene family member, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.674 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.39 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.97 | ||||
confidence value | 0.99 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | AUX/IAA | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsIAA10 | ||||
Function assigned as per literature | Knockdown of OsIAA10 enhances the resistance of rice toRice dwarf virus (RDV) infection | ||||
Subcellular localization as per literature | Nucleus and cytoplast | ||||
Cells used for localization experiment | Tobacco leaf | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 27606959 | ||||
Reference of localization | http://journals.plos.org/plospathogens/article?id=10.1371/journal.ppat.1005847 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.117 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os02g57250.1 protein MRGGVAGPTAGEPPGTEAEAEEVEESSAGDDEELELGLSLGSKKQQQQQHAPCRILTARDLQPAAALSPDSSVSSSSPAAAAAAGGKRAEGPTATTSPGT VASGHPHSSFGVVGWPPIRQFRMNSLFNQAKENTSETDTKKTATNESDVQKDKEEGEKKGRVAGWVKVNMDGEVIGRKVDLNAHRSYKTLALALELMFTK PSIGLCASHNTNSLKLLDNSAEYQLTYEDRDGDWMLVGDVPWEMFVSSVKRLRIMRTSDANGLGQRYQGIHRTIASTRGRS |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
Presence of Splice variants | YES |