RGAP LOCUS ID | LOC_Os02g55080 | ||||
RAP-DB ID | Os02g0793900 | ||||
Function | snf1-related kinase interactor 2, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.089 | ||||
3) NUCPRED Prediction |
|||||
localization | Nuclear | ||||
score | 0.89 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.99 | ||||
confidence value | 0.96 | ||||
Number Of Software Predicting Nucleus | 4 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | HDR1 | ||||
Function assigned as per literature | Associates with OsK4 and functionally regulate flowering time via the photoperiod-dependent pathway | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | rice leaf protoplasts | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 26954091 | ||||
Reference of localization | https://journals.plos.org/plosgenetics/article?id=10.1371/journal.pgen.1005927 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 2 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.148 | ||||
NLS score | 0.15 | ||||
Protein Sequence | >LOC_Os02g55080.1 protein MEEPASADPPRIFWKSRRRSASANGRSLQQELNKEAADEQLNNQAHEEAMKIDDANAVSTDDDVHPDPKANLSEKRKALFEPLEPINGKRSSAEMLLPPP DFEPASYPKGWLVGKKRKLVNVDVVESMRRIAIQEMNRKDREINGLNEQLEEDSRVLELLQKQLADERKKRTEIEKENSMLHEQVSMLMNMLDENEAFDE EGEAPPPDTL |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |