RGAP LOCUS ID | LOC_Os02g52140 | ||||
RAP-DB ID | Os02g0757900 | ||||
Function | RNA recognition motif containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 11 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.283 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.34 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 98.17 | ||||
confidence value | 0.92 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsPABN1 | ||||
Function assigned as per literature | |||||
Subcellular localization as per literature | NA | ||||
Cells used for localization experiment | |||||
NUCLEAR or Not Nuclear | |||||
PMID | |||||
Reference of localization | |||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.125 | ||||
NLS score | -0.04 | ||||
Protein Sequence | >LOC_Os02g52140.1 protein MDEEEHEVYGQEIPEDGDMDGADVDMASGGDDAAKLQELDQMKRRLKEMEEEAAALRDMQAKVAKEMQGGPPGGDPSASTAEAKEQVDARSVYVGNVDYA CTPEEVQQHFQACGTVNRVTILTDKFGQPKGFAYVEFLEQEAVQEALNLNESELHGRQIKVAPKRTNVPGMKQRPPRGYNPYHGYPYRSYGAPYFPPYGY GRVPRFRRPMRYRPYF |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | YES |