RGAP LOCUS ID | LOC_Os02g45450 | ||||
RAP-DB ID | Os02g0677300 | ||||
Function | dehydration-responsive element-binding protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 13 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.231 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.27 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 98.51 | ||||
confidence value | 0.72 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | AP2-EREBP/ERF | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsDREB1G | ||||
Function assigned as per literature | OsDREB1G is a typical CBF/DREB1 transcription factor that specifically functions in the cold stress response. | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Rice protoplasts | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 30984209 | ||||
Reference of localization | https://www.frontiersin.org/articles/10.3389/fpls.2019.00297/full | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 3 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.107 | ||||
NLS score | 1.07 | ||||
Protein Sequence | >LOC_Os02g45450.1 protein MDVSAALSSDYSSGTPSPVAADADDGSSAYMTVSSAPPKRRAGRTKFKETRHPVFKGVRRRNPGRWVCEVREPHGKQRIWLGTFETAEMAARAHDVAALA LRGRAACLNFADSPRRLRVPPIGASHDDIRRAAAEAAEAFRPPPDESNAATEVAAAASGATNSNAEQFASHPYYEVMDDGLDLGMQGYLDMAQGMLIDPP PMAGDPAVGSGEDDNDGEVQLWSY |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
Presence of Splice variants | No |