| RGAP LOCUS ID | LOC_Os02g43970 | ||||
| RAP-DB ID | Os02g0657000 | ||||
| Function | AP2 domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 14 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.002 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.5 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 100 | ||||
| confidence value | 0.98 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | AP2-EREBP/ERF | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | ARAG1 | ||||
| Function assigned as per literature | ARAG1 is an ABA-responsive DREB gene and plays a role in seed germination and drought tolerance of rice | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | Onion epidermis cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 20100696 | ||||
| Reference of localization | https://academic.oup.com/aob/article/105/3/401/91967 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 5 | ||||
| Number of PAT7 | 1 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.098 | ||||
| NLS score | 1.27 | ||||
| Protein Sequence | >LOC_Os02g43970.1 protein MDDSSFGSEPTTSSSGGEAPASPPSTASSSSDGAGGKKKRPRKDGHHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALAIKGRA AHLNFPDLAHELPRPATAAPKDVQAAAALAAAADFPASSANAGASNNPDGSDDASAGSASPPPPPDAADDALFDLPDLLLDLRYGPPSSGLSCASSWEDE VGLISGAGAAAAGVFRLEEPLLWEY |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| 6 |
|
||||
| Presence of Splice variants | No | ||||