RGAP LOCUS ID | LOC_Os02g43970 | ||||
RAP-DB ID | Os02g0657000 | ||||
Function | AP2 domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.002 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.5 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 100 | ||||
confidence value | 0.98 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | AP2-EREBP/ERF | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | ARAG1 | ||||
Function assigned as per literature | ARAG1 is an ABA-responsive DREB gene and plays a role in seed germination and drought tolerance of rice | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Onion epidermis cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 20100696 | ||||
Reference of localization | https://academic.oup.com/aob/article/105/3/401/91967 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 5 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.098 | ||||
NLS score | 1.27 | ||||
Protein Sequence | >LOC_Os02g43970.1 protein MDDSSFGSEPTTSSSGGEAPASPPSTASSSSDGAGGKKKRPRKDGHHPTYRGVRMRSWGKWVSEIREPRKKSRIWLGTFATAEMAARAHDVAALAIKGRA AHLNFPDLAHELPRPATAAPKDVQAAAALAAAADFPASSANAGASNNPDGSDDASAGSASPPPPPDAADDALFDLPDLLLDLRYGPPSSGLSCASSWEDE VGLISGAGAAAAGVFRLEEPLLWEY |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
Presence of Splice variants | No |