RGAP LOCUS ID | LOC_Os02g43790 | ||||
RAP-DB ID | Os02g0654700 | ||||
Function | ethylene-responsive transcription factor, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 12 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.731 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.6 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.89 | ||||
confidence value | 0.9 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | AP2-EREBP/ERF | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | AP59|OsBIERF3|OsAP59 | ||||
Function assigned as per literature | OsBIERF3 may participate in disease resistance response and stress responses to abiotic factors | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Onion epidermis cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 16436304 | ||||
Reference of localization | https://www.sciencedirect.com/science/article/pii/S0176161705004517?via%3Dihub | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 3 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.099 | ||||
NLS score | 0.84 | ||||
Protein Sequence | >LOC_Os02g43790.1 protein MLLNPASREVAALDSIRHHLLEEEEETPATAPAPTRRPVYCRSSSFGSLVADQWSESLPFRPNDAEDMVVYGALRDAFSSGWLPDGSFAAVKPESQDSYD GSSIGSFLASSSSEAGTPGEVTSTEATVTPGIREGEGEAVAVASRGKHYRGVRQRPWGKFAAEIRDPAKNGARVWLGTFDSAEEAAVAYDRAAYRMRGSR ALLNFPLRIGSEIAAAAAAAAAGNKRPYPDPASSGSSSPSSSSSSSSSSSSGSPKRRKRGEAAAASMAMALVPPPPPPAQAPVQLALPAQPWFAAGPIQQ LVS |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
7 |
|
||||
Presence of Splice variants | No |