LOC_Os02g39390
| RGAP LOCUS ID | LOC_Os02g39390 |
| RAP-DB ID | Os02g0606700 |
| Function | expressed protein |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | cyto |
| score | 6.5 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 2.712 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.26 |
4) Y-Loc Prediction |
|
| localization | Chloroplast |
| score | 6 |
| confidence value | 0.14 |
| Number Of Software Predicting Nucleus | 1 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | RSS1 |
| Function assigned as per literature | RSS1 regulates the cell cycle and maintains meristematic activity under stress conditions |
| Subcellular localization as per literature | Nucleus and cytosol |
| Cells used for localization experiment | Onion epidermal cells |
| NUCLEAR or Not Nuclear | NUCLEAR |
| PMID | 21505434 |
| Reference of localization | https://www.nature.com/articles/ncomms1279 |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 1 |
| Number of Bipartite | 0 |
| Basic residues % | 0.16 |
| NLS score | -0.22 |
| Protein Sequence | >LOC_Os02g39390.1 protein MAAPTATAVFLDENLHIHRGPAGKRADGLKAKPLKPLAAKQGLQEKKALRDVSNIGKPPVSTRKPLQDVSNTAKPRGRNISDGTTLKKTALRSHEATKNP VKKTVIFSDETAKCHEWAKDGVEGTHFTGNDSQKLEKDSQDKRVKKKVEKIMSALHDWPDAVFDHVLFPSEVVAAFFEEVKEMELEPEILPENNRRRSSS GDKMKLAEDPFTEDELDYYPFLENNPVEFQLRDELPLLEPGMN |
GO Analysis |
|
| Presence of Splice variants | YES |