RGAP LOCUS ID | LOC_Os02g38230 | ||||
RAP-DB ID | Os02g0595900 | ||||
Function | high affinity nitrate transporter, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | plas | ||||
score | 7 | ||||
2) CELLO Prediction |
|||||
localization | Extracellular | ||||
score | 1.005 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.07 | ||||
4) Y-Loc Prediction |
|||||
localization | Secreted pathw | ||||
score | |||||
confidence value | 0.59 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsNAR2.1 | ||||
Function assigned as per literature | OsNAR2.1 protein are key amino acids in the interaction with OsNRT2.3a | ||||
Subcellular localization as per literature | PM and cytoplasm | ||||
Cells used for localization experiment | rice blade protoplasts and tobacco epidermis cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 25103875 | ||||
Reference of localization | https://nph.onlinelibrary.wiley.com/doi/full/10.1111/nph.12986 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.121 | ||||
NLS score | -0.16 | ||||
Protein Sequence | >LOC_Os02g38230.1 protein MARLAGVAALSLVLVLLGAGVPRPAAAAAAKTQVFLSKLPKALVVGVSPKHGEVVHAGENTVTVTWSLNTSEPAGADAAFKSVKVKLCYAPASRTDRGWR KASDDLHKDKACQFKVTVQPYAAGAGRFDYVVARDIPTASYFVRAYAVDASGTEVAYGQSSPDAAFDVAGITGIHASLKVAAGVFSTFSIAALAFFFVVE KRKKDK |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
Presence of Splice variants | No |