| RGAP LOCUS ID | LOC_Os02g36924 | ||||
| RAP-DB ID | Os02g0579600 | ||||
| Function | OsMADS27 - MADS-box family gene with MIKCc type-box, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 10.5 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.352 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.67 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 99.98 | ||||
| confidence value | 0.95 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | MIKC_MADS | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsMADS27 | ||||
| Function assigned as per literature | OsMADS27 is an important regulator controlling the root system development and adaption to osmotic stress in rice. | ||||
| Subcellular localization as per literature | OsMADS27 is colocalized with OsSLR1 in nucleus | ||||
| Cells used for localization experiment | Onion epidermal cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 30466586 | ||||
| Reference of localization | https://www.sciencedirect.com/science/article/pii/S0168945218306046?via%3Dihub | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 1 | ||||
| Basic residues % | 0.146 | ||||
| NLS score | 0.02 | ||||
| Protein Sequence | >LOC_Os02g36924.1 protein MGRGKIVIRRIDNSTSRQVTFSKRRNGIFKKAKELAILCDAEVGLMIFSSTGRLYEYSSTSMKSVIDRYGKSKDEQQAVANPNSELKFWQREAASLRQQL HNLQENHRQLMGEDLSGLNVKELQSLENQLEISLRSVRTKKDHVLIDEIHELNRKGSLVHQENMELYKKISLIRQENAELYKKIYETEGPSEVNRDSPTP YNFAVIEKTNVPVQLGLSTLPQHSDAEQSTAPKLGLQLNP |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| 6 |
|
||||
| Presence of Splice variants | No | ||||