| RGAP LOCUS ID | LOC_Os02g35329 | ||||
| RAP-DB ID | Os02g0559800 | ||||
| Function | RING-H2 finger protein ATL3F, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 5 | ||||
2) CELLO Prediction |
|||||
| localization | Chloroplast | ||||
| score | 1.223 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.19 | ||||
4) Y-Loc Prediction |
|||||
| localization | Cytoplasm | ||||
| score | 91 | ||||
| confidence value | 0.47 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | EL5 | ||||
| Function assigned as per literature | EL5 is involved in root development through the maintenance of cell viability in rice | ||||
| Subcellular localization as per literature | Plasma membrane | ||||
| Cells used for localization experiment | Transgenic callus cells | ||||
| NUCLEAR or Not Nuclear | Not Nuclear | ||||
| PMID | 17559513 | ||||
| Reference of localization | https://onlinelibrary.wiley.com/doi/epdf/10.1111/j.1365-313X.2007.03120.x | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 3 | ||||
| Number of PAT7 | 2 | ||||
| Number of Bipartite | 2 | ||||
| Basic residues % | 0.089 | ||||
| NLS score | 2.13 | ||||
| Protein Sequence | >LOC_Os02g35329.1 protein MVRGVEQGGPAMDESSSSSSPSPVSAPAGQAAMTAGGIATVAAVLIVFAALTLAFVLLQCYCDERRRAVTTTSTSGRGRRPRPRRRSGSGGDGGTGGGVD PEVLRSLPVTVYSRSTAAAAAKEEEEEDDDGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPLCRLTVVVPPPPLPPVPPEPPASYTVS LPASVLLGLSDHGAGAVTMTAEGRSTLVIEIPESAASTTPRDAAARSSPSLARLRSLRRLWSFGRQGAAGSTSSCSCATGGDNDDGDVEHGVSVTVAIRA VEAATPARPPEAEAGARTAAAHVRN |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | No | ||||