RGAP LOCUS ID | LOC_Os02g20170 | ||||
RAP-DB ID | Os02g0304900 | ||||
Function | drought induced 19 protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 11 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.877 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.68 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 93.21 | ||||
confidence value | 0.56 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsDi19-4 | ||||
Function assigned as per literature | OsDi19-4 to positively regulate ABA response by modulating the expression of ABA‐responsive genes in rice | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | N. benthamiana leaves | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 27627618 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/full/10.1111/pce.12829 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 2 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.114 | ||||
NLS score | 0.15 | ||||
Protein Sequence | >LOC_Os02g20170.1 protein MDSDHWISRLMAAKRQYALQRAQNHHHATATATATAASHSHLDRYGYDDVEPEDEVRPDFPCPYCYEDHDITSLCAHLEDEHPFESKVVACPVCSARISK DLLDHITLQHSYLYYLQRHHRLRRVAVPSNHALSLGGRDLQETYLKVLLGNSSRSSGTNAASSVTDSLLSSLVLNLSSSEAEDTAKFSALAVVENNWFKR TLPSKTWKASSDSNLSQEERERRRRRAAVRSSFVQHLLVSTLFDD |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
Presence of Splice variants | No |