| RGAP LOCUS ID | LOC_Os02g10200 | ||||
| RAP-DB ID | Os02g0195600 | ||||
| Function | zinc finger A20 and AN1 domain-containing stress-associated protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | cyto | ||||
| score | 9 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 1.149 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.09 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 76.79 | ||||
| confidence value | 0.65 | ||||
| Number Of Software Predicting Nucleus | 2 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | ZFP185 | ||||
| Function assigned as per literature | ZFP185 regulates plant growth and stress responses by affecting GA and ABA biosynthesis in rice | ||||
| Subcellular localization as per literature | cytoplasm | ||||
| Cells used for localization experiment | rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 26512055 | ||||
| Reference of localization | https://academic.oup.com/jxb/article/67/1/315/2885156 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.127 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os02g10200.1 protein MEHKEAGCQQPEGPILCINNCGFFGSAATMNMCSKCHKEMIMKEEQAKLAASSIDSIVNGCDGGKEHIVAASGSTAVAVAQVEAKTLVVQPTDVAGTSEE VAVVPKVKEGPNRCATCRKRVGLTGFNCRCGNMYCALHRYSDKHECQFDYRTAARDAIAKANPVVKAEKLDKI |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | YES | ||||