 
    | RGAP LOCUS ID | LOC_Os02g09830 | ||||
| RAP-DB ID | Os02g0191600 | ||||
| Function | bZIP transcription factor domain containing protein, expressed | ||||
| Sub-cellular Localization Predictions | |||||
| 1) WoLF-PSORT Prediction | |||||
| localization | Nuclear | ||||
| score | 14 | ||||
| 2) CELLO Prediction | |||||
| localization | Nuclear | ||||
| score | 4.306 | ||||
| 3) NUCPRED Prediction | |||||
| localization | Nuclear | ||||
| score | 0.84 | ||||
| 4) Y-Loc Prediction | |||||
| localization | Nuclear | ||||
| score | 100 | ||||
| confidence value | 0.99 | ||||
| Number Of Software Predicting Nucleus | 4 | ||||
| Seed Specific | No | ||||
| Transcription factor category | bZIP | ||||
| Experimental evidence for subcellular localization | |||||
| Published gene name (updated 1 January 2020) | OsbZIP16 | ||||
| Function assigned as per literature | Positively regulates drought resistance in rice | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | onion cell layers. | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 22794914 | ||||
| Reference of localization | https://www.sciencedirect.com/science/article/pii/S0168945212001008?via%3Dihub | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
| Sequence Analysis | |||||
| Number of PAT4 | 2 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 4 | ||||
| Basic residues % | 0.135 | ||||
| NLS score | 2.13 | ||||
| Protein Sequence | >LOC_Os02g09830.1 protein MQHDAISNIAYHPSMDFTSFFLPQTDAYSHDLSALLDMAVVDPYISCNGSSITMIPVTEDEANAQPMNHGNDERKKRRLVSNRESARRSRVRKQRRLDEL SSQVSELRDTNQRLLVELNHMISKHARIVRENSQLREEASDLQRKLSEMKMEDAEVAAAAAAAPRTLEVA | ||||
| GO Analysis | |||||
| 1 | 
 | ||||
| 2 | 
 | ||||
| 3 | 
 | ||||
| 4 | 
 | ||||
| 5 | 
 | ||||
| Presence of Splice variants | No | ||||