RGAP LOCUS ID | LOC_Os02g09830 | ||||
RAP-DB ID | Os02g0191600 | ||||
Function | bZIP transcription factor domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 4.306 | ||||
3) NUCPRED Prediction |
|||||
localization | Nuclear | ||||
score | 0.84 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 100 | ||||
confidence value | 0.99 | ||||
Number Of Software Predicting Nucleus | 4 | ||||
Seed Specific | No | ||||
Transcription factor category | bZIP | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsbZIP16 | ||||
Function assigned as per literature | Positively regulates drought resistance in rice | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | onion cell layers. | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 22794914 | ||||
Reference of localization | https://www.sciencedirect.com/science/article/pii/S0168945212001008?via%3Dihub | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 2 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 4 | ||||
Basic residues % | 0.135 | ||||
NLS score | 2.13 | ||||
Protein Sequence | >LOC_Os02g09830.1 protein MQHDAISNIAYHPSMDFTSFFLPQTDAYSHDLSALLDMAVVDPYISCNGSSITMIPVTEDEANAQPMNHGNDERKKRRLVSNRESARRSRVRKQRRLDEL SSQVSELRDTNQRLLVELNHMISKHARIVRENSQLREEASDLQRKLSEMKMEDAEVAAAAAAAPRTLEVA |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | No |