LOC_Os02g05890
| RGAP LOCUS ID | LOC_Os02g05890 |
| RAP-DB ID | Os02g0152900 |
| Function | EMB1303, putative, expressed |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | chlo |
| score | 8 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 2.033 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.54 |
4) Y-Loc Prediction |
|
| localization | Chloroplast |
| score | 9 |
| confidence value | 0.62 |
| Number Of Software Predicting Nucleus | 1 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | YL1|YS83 |
| Function assigned as per literature | YL1 is involved in chloroplast development and efficient biogenesis of chloroplast ATP synthase in rice |
| Subcellular localization as per literature | Chloroplast |
| Cells used for localization experiment | Rice protoplasts |
| NUCLEAR or Not Nuclear | NOT NUCLEAR |
| PMID | 27585744 |
| Reference of localization | https://www.nature.com/articles/srep32295 |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 0 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.115 |
| NLS score | -0.47 |
| Protein Sequence | >LOC_Os02g05890.1 protein MPPLATMSSPGSLLLLTPAVYQGIGRNRGGQSQEGQSISSSRSLKTKLSVSARAVSSCEASMRITCCANQTQTARRKSFSGPTSPPSGSVKEKVRSPKLD DGGTGFPPFRFGGGGGGGGGGGSNSAGGFILFVIVLLLDYLREFERNLQNGTRRGSDYDNGLAPQ |
GO Analysis |
|
| Presence of Splice variants | No |