LOC_Os02g04160
| RGAP LOCUS ID | LOC_Os02g04160 | ||||
| RAP-DB ID | Os02g0134300 | ||||
| Function | transcription elongation factor 1, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 6 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.489 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.51 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 99.71 | ||||
| confidence value | 0.84 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsTEF1 | ||||
| Function assigned as per literature | |||||
| Subcellular localization as per literature | NA | ||||
| Cells used for localization experiment | |||||
| NUCLEAR or Not Nuclear | |||||
| PMID | |||||
| Reference of localization | |||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 1 | ||||
| Number of PAT7 | 3 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.143 | ||||
| NLS score | 0.98 | ||||
| Protein Sequence | >LOC_Os02g04160.1 protein MGKRKSKAKPPPKKRMDKLDTVFCCPFCNHGSSVECRIDLKNLIGEASCRICLETFSTSVNALTEPIDIYSEWIDECERVNNPEEDNANHYEDDNASRYR YDEEE |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| Presence of Splice variants | YES | ||||