| RGAP LOCUS ID | LOC_Os02g03060 | 
                        
                            | RAP-DB ID | Os02g0123100 | 
                        
                            | Function | cyclin-dependent kinase A-2, putative, expressed | 
                        
                            | Sub-cellular Localization
                                    Predictions | 
                        
                            | 1) WoLF-PSORT Prediction | 
                        
                            | localization | chlo | 
                        
                            | score | 7 | 
                        
                            | 2) CELLO
                                    Prediction | 
                        
                            | localization | Nuclear | 
                        
                            | score | 1.523 | 
                        
                            | 3) NUCPRED
                                    Prediction | 
                        
                            | localization | Non Nuclear | 
                        
                            | score | 0.14 | 
                        
                            | 4) Y-Loc
                                    Prediction | 
                        
                            | localization | Nuclear | 
                        
                            | score | 86.61 | 
                        
                            | confidence value | 0.19 | 
                        
                            | Number Of Software Predicting Nucleus | 2 | 
                        
                            | Seed Specific | No | 
                        
                            | Transcription factor category |  | 
                        
                            | Experimental evidence for
                                    subcellular localization | 
                        
                            | Published gene name (updated 1 January 2020) | cdc2Os-2|CDKA2 | 
                        
                            | Function assigned as per literature |  | 
                        
                            | Subcellular localization as per literature | NA | 
                        
                            | Cells used for localization experiment |  | 
                        
                            | NUCLEAR or Not Nuclear |  | 
                        
                            | PMID |  | 
                        
                            | Reference of localization |  | 
                        
                            | Is Subcellular localization evidence by author available ? | No | 
                                                
                            | Sequence Analysis | 
                        
                            | Number of PAT4 | 0 | 
                        
                            | Number of PAT7 | 0 | 
                        
                            | Number of Bipartite | 0 | 
                        
                            | Basic residues % | 0.106 | 
                        
                            | NLS score | -0.47 | 
                        
                            | Protein Sequence | >LOC_Os02g03060.1 protein MPQAQPNSSPSPPPHTHTHAHHSSPHNPSTPTPPPPPGSPRDGAGEHPSTSAMTMPFAVSDPSASVEEMVAAAAADDECVCVWLEEQYEKVEKIGEGTYG
 VVYKGKHRHTNETIALKKIRLEQEDEGVPSTAIREISLLKEMQHRNIVRLQDVVHKEKCIYLVFEYLDLDLKKHMDSSPDFKNHRIVKSFLYQILRGIAY
 CHSHRVLHRDLKPQNLLIDRRTNSLKLADFGLARAFGIPVRTFTHEVVTLWYRAPEILLGARHYSTPVDMWSVGCIFAEMVNQKPLFPGDSEIDELFKIF
 SIMGTPNEETWPGVASLPDYISTFPKWPSVDLATVVPTLDSSGLDLLSKMLRLDPSKRINARAALEHEYFKDLEVA
 | 
                        
                            | GO Analysis | 
                                                        
                                    | 1 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | metabolic process |  | 
                                                                
                                    | 2 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | cellular process |  | 
                                                                
                                    | 3 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | multicellular organismal development |  | 
                                                                
                                    | 4 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | DNA metabolic process |  | 
                                                                
                                    | 5 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | biosynthetic process |  | 
                                                                
                                    | 6 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | cell cycle |  | 
                                                                
                                    | 7 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | cytoskeleton |  | 
                                                                
                                    | 8 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | cytoplasm |  | 
                                                                
                                    | 9 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | kinase activity |  | 
                                                                
                                    | 10 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | protein binding |  | 
                                                                
                                    | 11 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | cytosol |  | 
                                                                
                                    | 12 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | plasma membrane |  | 
                                                                
                                    | 13 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | nucleus |  | 
                                                                
                                    | 14 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | response to stress |  | 
                                                                
                                    | 15 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | response to abiotic stimulus |  | 
                                                                
                                    | 16 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | protein modification process |  | 
                                                                
                                    | 17 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | reproduction |  | 
                                                                
                                    | 18 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | post-embryonic development |  | 
                                                                
                                    | 19 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | embryo development |  | 
                                                        
                            | Presence of Splice variants | YES |