LOC_Os02g01220
| RGAP LOCUS ID | LOC_Os02g01220 | ||||
| RAP-DB ID | Os02g0102300 | ||||
| Function | rhodanese-like domain containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | cyto | ||||
| score | 14 | ||||
2) CELLO Prediction |
|||||
| localization | Extracellular | ||||
| score | 1.475 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.01 | ||||
4) Y-Loc Prediction |
|||||
| localization | Cytoplasm | ||||
| score | 85 | ||||
| confidence value | 0.32 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsHAC1;1 | ||||
| Function assigned as per literature | OsHAC1;1 and OsHAC1;2 are arsenate reductases that play an important role in restricting As accumulation in rice shoots and grain. | ||||
| Subcellular localization as per literature | Cytoplams and nucleus | ||||
| Cells used for localization experiment | Protoplasts from the transgenic rice roots | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 27702843 | ||||
| Reference of localization | http://www.plantphysiol.org/content/plantphysiol/172/3/1708.full.pdf | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.073 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os02g01220.1 protein MAPPYETSAAGSESPVPVVTVDVAAASDLITSAGHRYVDVRTEEEMNKGHLHNSLNVPFMFVTPQGREKNPLFVEQFSSLVSKEEHVVVGCQSGKRSELA CVDLLEAGFKNVKNMGGGYAAWLDNGFPINTPPHTMY |
||||
GO Analysis |
|||||
| 1 |
|
||||
| Presence of Splice variants | No | ||||