RGAP LOCUS ID | LOC_Os01g73770 | ||||
RAP-DB ID | Os01g0968800 | ||||
Function | dehydration-responsive element-binding protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 14 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.595 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.58 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 91.29 | ||||
confidence value | 0.3 | ||||
Number Of Software Predicting Nucleus | 3 | ||||
Seed Specific | No | ||||
Transcription factor category | AP2-EREBP/ERF | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsDREB1F|RCBF2 | ||||
Function assigned as per literature | OsDREB1F gene play a role in salt, drought, and low temperature tolerance in both Arabidopsis and rice | ||||
Subcellular localization as per literature | Nucleus | ||||
Cells used for localization experiment | Onion epidermis cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 18470484 | ||||
Reference of localization | https://link.springer.com/article/10.1007%2Fs11103-008-9340-6 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 1 | ||||
Number of PAT7 | 2 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.123 | ||||
NLS score | 0.64 | ||||
Protein Sequence | >LOC_Os01g73770.1 protein MDTEDTSSASSSSVSPPSSPGGGHHHRLPPKRRAGRKKFRETRHPVYRGVRARAGGSRWVCEVREPQAQARIWLGTYPTPEMAARAHDVAAIALRGERGA ELNFPDSPSTLPRARTASPEDIRLAAAQAAELYRRPPPPLALPEDPQEGTSGGGATATSGRPAAVFVDEDAIFDMPGLIDDMARGMMLTPPAIGRSLDDW AAIDDDDDHYHMDYKLWMD |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
Presence of Splice variants | No |