| RGAP LOCUS ID | LOC_Os01g73450 | ||||
| RAP-DB ID | Os01g0965400 | ||||
| Function | amino acid kinase, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 14 | ||||
2) CELLO Prediction |
|||||
| localization | Chloroplast | ||||
| score | 3.607 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.12 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 9 | ||||
| confidence value | 0.75 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | YGL8|YL2 | ||||
| Function assigned as per literature | YL2 encodes a UMP kinase-like protein in rice and play an important role in the accumulation of AtpA/AtpB subunits of cpATPase complex, which is essential for proper chloroplast development in rice | ||||
| Subcellular localization as per literature | Chloroplasts | ||||
| Cells used for localization experiment | Rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 29392476 | ||||
| Reference of localization | https://link.springer.com/article/10.1007%2Fs11120-017-0477-5 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 1 | ||||
| Number of PAT7 | 1 | ||||
| Number of Bipartite | 1 | ||||
| Basic residues % | 0.111 | ||||
| NLS score | 0.61 | ||||
| Protein Sequence | >LOC_Os01g73450.1 protein MAAAAAAAVACGMSTSFLIRLSPSPPASSHVPLPRSPASSARPRRASSVSLSTAPRPRARAAGSDSPSNFGGQTSLMPPFSLMLDEGSRSKKPYRWQRVL LKVSGEALAGDHTENIDPKITMAIAREVASVTRLGVEVAIVVGGGNIFRGASWAGCSGLDRSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAFRMSE VAEPYIRRRAVRHLEKGRVVIFAAGTGNPFFTTDTAAALRCAEINAEVVLKATNVDGVYDADPKRNPNARLLEAVSYHEVQTRDLSVMDMTAITLCQENN IPVVVFNLQKPGNIAKAIVGEKVGTFIGCTKDQDQIVGNALDQERRLVNEL |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| Presence of Splice variants | No | ||||