LOC_Os01g72910
| RGAP LOCUS ID | LOC_Os01g72910 |
| RAP-DB ID | Os01g0959200 |
| Function | abscisic stress-ripening, putative, expressed |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | Nuclear |
| score | 8 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 2.551 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.08 |
4) Y-Loc Prediction |
|
| localization | Nuclear |
| score | 97.17 |
| confidence value | 0.5 |
| Number Of Software Predicting Nucleus | 3 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | Asr2 |
| Function assigned as per literature | |
| Subcellular localization as per literature | NA |
| Cells used for localization experiment | |
| NUCLEAR or Not Nuclear | |
| PMID | |
| Reference of localization | |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 2 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.2 |
| NLS score | -0.1 |
| Protein Sequence | >LOC_Os01g72910.1 protein MFGHHKNEEKMAAAGAAPKDAGDYRKEEKHHKHMEQIAKLGAAAAGAYAMHEKKQAKKDPEHARSHKMKEGIAAAVAVGSAGFALHEHHEKKEAKKHRRH AHHHH |
GO Analysis |
|
| Presence of Splice variants | No |