LOC_Os01g72480
| RGAP LOCUS ID | LOC_Os01g72480 | ||||
| RAP-DB ID | Os01g0954400 | ||||
| Function | zinc finger, C3HC4 type domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 13 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.328 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.37 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 7 | ||||
| confidence value | 0.08 | ||||
| Number Of Software Predicting Nucleus | 2 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsPIE1 | ||||
| Function assigned as per literature | OsPIE1 plays an important role in maintaining Pi homeostasis in rice. | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | tobacco leaves | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 30329110 | ||||
| Reference of localization | https://academic.oup.com/pcp/article-abstract/59/12/2564/5133771 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 1 | ||||
| Number of PAT7 | 1 | ||||
| Number of Bipartite | 1 | ||||
| Basic residues % | 0.125 | ||||
| NLS score | 0.7 | ||||
| Protein Sequence | >LOC_Os01g72480.1 protein MAAAAAAAASASSSSSSSSSAESVPLPTTTLPIDKAAAVGGGGDRAVDCGVCAICLDKIALQETALVKGCDHAYCVTCILRWASYKQTPQCPQCKHPFDF LSVHRSLDGCIHDYMFEESVCLLLRATWFEPLIVEAHEEALDEEELYHIYQYDDGVEDDLDEEAYYMSRSPSIRIGNRRWGDNGYVRGGRKEARPVSRQS LNDTDAGPSRTPKKKDVSASGSGSVSKEVAGRRAKRALKREAADKAAAEKHLKHLQRLGLRKAPEATAEATPEVEPQLNE |
||||
GO Analysis |
|||||
| 1 |
|
||||
| Presence of Splice variants | No | ||||