RGAP LOCUS ID | LOC_Os01g68860 | ||||
RAP-DB ID | Os01g0917400 | ||||
Function | zinc finger C-x8-C-x5-C-x3-H type family protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 3.694 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.39 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 6 | ||||
confidence value | 0.09 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | C3H | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | C3H12 | ||||
Function assigned as per literature | C3H12, as a nucleic acid-binding protein, positively and quantitatively regulates rice resistance to Xoo and that its function is likely associated with the JA-dependent pathway | ||||
Subcellular localization as per literature | Nucleus (using two different types of putative NLSs, a bipartite signal at the N terminus, and an SV40-type NLS at the C terminus ) | ||||
Cells used for localization experiment | onion epidermal cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 22158700 | ||||
Reference of localization | http://www.plantphysiol.org/content/158/2/876.long | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.089 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os01g68860.1 protein MDDAGRASAPAVVTVTASAAAPTPPLPPPPPPPPPSQLPATAAATDEPSHDPAALYGEGMWQQMTMSGSGAMQPGPYPERSGEPDCTYYLRTGLCRFGMS CRFNHPQDRNLAIASARMKGEYPERMGQPECQYYLKTGTCKFGPTCKFHHPREKAGIAGRVQLNTLGYPLRPSEKECAYYLKTGQCKYGNTCKFHHPELF NAMASSRGSPIYPSVHSSATAGPPYTGTMASWAFPRGSFIPSPRWQNPSNYAPMIVPQGLVQVPSWNSYTGQMMPVSSSESRLQSPGAQQTYGTSQQVDA SAGNQGMLSPYRSSSYPVPQYALQRENVFPERPDQPECQYYMKTGDCKFGAVCKFHHPRVRSMPTPDCVLSPVGLPLRPGEELCKFYSRYGICKFGANCK FDHPTMAPPMGVYAYGSASTNVPMVRRLLQSPSASAYTS |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | YES |