| RGAP LOCUS ID | LOC_Os01g66590 | ||||
| RAP-DB ID | Os01g0889400 | ||||
| Function | DUF260 domain containing protein, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 12 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.453 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.25 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 9 | ||||
| confidence value | 0.1 | ||||
| Number Of Software Predicting Nucleus | 1 | ||||
| Seed Specific | No | ||||
| Transcription factor category | LBD | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsIG1 | ||||
| Function assigned as per literature | OsIG1 plays an essential role in the regulation of empty-glume identity, floral organ number control and female gametophyte development in rice | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | Arabidopsis mesophyll protoplasts | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 25324400 | ||||
| Reference of localization | https://academic.oup.com/jxb/article/66/1/99/2893393 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.071 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os01g66590.2 protein MASSSASSVPAPSGSVITIASASASAAANTAACGTGSPCAACKFLRRKCQPDCVFAPYFPPDNPQKFVHVHRVFGASNVTKLLNELHPYQREDAVNSLAY EADMRLRDPVYGCVAIISILQRNLRQLQQDLARAKFELSKYQQAAAAAAAASASTGTNNGPHSMAEFIGNAVPNGAQSFINVGHSAALASVGGAAACFGQ EQQFSAVHMLSRSYEGEPIARLGGNGGYEFGYSTSMAGGGHMSGLGALGGAPFLKSGIAGSDERQGAGQ |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| Presence of Splice variants | YES | ||||