| RGAP LOCUS ID | LOC_Os01g60490 | ||||
| RAP-DB ID | Os01g0820400 | ||||
| Function | WRKY22, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 10 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.903 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.52 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 99.69 | ||||
| confidence value | 0.8 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | WRKY | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsWRKY22 | ||||
| Function assigned as per literature | WRKY22 promotes aluminum tolerance via activation of OsFRDL4 expression and enhancement of citrate secretion in rice | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | Nicotiana benthamiana leaves | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 29658118 | ||||
| Reference of localization | https://nph.onlinelibrary.wiley.com/doi/epdf/10.1111/nph.15143 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.113 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os01g60490.1 protein MVKRSDNMDSSSECSRGAHKRLLQDSRSYDQENAMKKVCIGTRTEYTYAPYHDGYQWRKYGQKMIRGNSFPRCYYRCTYHQDHGCPASKHVEQHNSEDPP LFRVIYTNEHTCGTSNSASDYMASSMQIQQIADASLRKAQAAERLRKAEVETPRLMHSPPPRCSGGYNMAMKEEKDVIVSSLLTVIRGCHIAESAGNNSA AALPVNRPPPAVARSDHYSCSYAISPELLPASDDLTLDFMLDSVLDPHWVEPLDLAWLKESTHTG |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | No | ||||