| RGAP LOCUS ID | LOC_Os01g59530 | ||||
| RAP-DB ID | Os01g0810300 | ||||
| Function | OsCML1 - Calmodulin-related calcium sensor protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 10.5 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.247 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.67 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 75.77 | ||||
| confidence value | 0.76 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsCaM61 | ||||
| Function assigned as per literature | OsCaM61 may play functions in co-ordinating Ca2+ signaling with isoprenoid metabolism | ||||
| Subcellular localization as per literature | When prenylated OsCaM61 molecules are mainly membrane-associated whereas its unprenylated counterparts are transported into the nucleoplasm | ||||
| Cells used for localization experiment | Stable transformed tobacco TBY2 cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 11855722 | ||||
| Reference of localization | https://link.springer.com/article/10.1023/A:1013380814919 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 3 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.15 | ||||
| NLS score | 0.47 | ||||
| Protein Sequence | >LOC_Os01g59530.1 protein MADQLSEEQIGEFREAFSLFDKDGDGSITTKELGTVMRSLGQNPTEAELQDMISEVDTDSNGNIEFKEFLGLMARKLRDKDSEEELKEAFRVFDKDQNGF ISATELRHVMANIGERLTDEEVGEMISEADVDGDGQINYEEFVKCMMAKKRRKRIEEKRDHDGGSRTKSAGPSAAPASKRGQKCVIL |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| Presence of Splice variants | YES | ||||