LOC_Os01g59440
| RGAP LOCUS ID | LOC_Os01g59440 | ||||
| RAP-DB ID | Os01g0809300 | ||||
| Function | BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | extr | ||||
| score | 9 | ||||
2) CELLO Prediction |
|||||
| localization | Extracellular | ||||
| score | 2.668 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.04 | ||||
4) Y-Loc Prediction |
|||||
| localization | Secreted pathw | ||||
| score | |||||
| confidence value | 0.99 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsLRR1 | ||||
| Function assigned as per literature | OsLRR1 enters the endosomal pathway and interacts with the hypersensitive induced reaction protein 1, OsHIR1 | ||||
| Subcellular localization as per literature | Endosomes | ||||
| Cells used for localization experiment | transgenic tobacco BY-2 cells | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 19712067 | ||||
| Reference of localization | https://onlinelibrary.wiley.com/doi/epdf/10.1111/j.1365-3040.2009.02039.x | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.08 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os01g59440.1 protein MGAGALGVVAMVAAAVVVAMAGANSEGDALSALRRSLRDPGGVLQSWDPTLVNPCTWFHVTCDRDNRVTRLDLGNLNLSGHLVPELGKLDHLQYLELYKN NIQGTIPSELGNLKNLISLDLYKNNISGTIPPTLGKLTSLVFLRLNGNRLTGPIPRELAGISSLKVVDVSSNDLCGTIPTSGPFEHIPLSNFEKNPRLEG PELQGLAVYDTNC |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| Presence of Splice variants | YES | ||||