RGAP LOCUS ID | LOC_Os01g59440 | ||||
RAP-DB ID | Os01g0809300 | ||||
Function | BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | extr | ||||
score | 9 | ||||
2) CELLO Prediction |
|||||
localization | Extracellular | ||||
score | 2.668 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.04 | ||||
4) Y-Loc Prediction |
|||||
localization | Secreted pathw | ||||
score | |||||
confidence value | 0.99 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsLRR1 | ||||
Function assigned as per literature | OsLRR1 enters the endosomal pathway and interacts with the hypersensitive induced reaction protein 1, OsHIR1 | ||||
Subcellular localization as per literature | Endosomes | ||||
Cells used for localization experiment | transgenic tobacco BY-2 cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 19712067 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/epdf/10.1111/j.1365-3040.2009.02039.x | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.08 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os01g59440.1 protein MGAGALGVVAMVAAAVVVAMAGANSEGDALSALRRSLRDPGGVLQSWDPTLVNPCTWFHVTCDRDNRVTRLDLGNLNLSGHLVPELGKLDHLQYLELYKN NIQGTIPSELGNLKNLISLDLYKNNISGTIPPTLGKLTSLVFLRLNGNRLTGPIPRELAGISSLKVVDVSSNDLCGTIPTSGPFEHIPLSNFEKNPRLEG PELQGLAVYDTNC |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
Presence of Splice variants | YES |