RGAP LOCUS ID | LOC_Os01g50940 | ||||
RAP-DB ID | Os01g0705700 | ||||
Function | helix-loop-helix DNA-binding domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 8 | ||||
2) CELLO Prediction |
|||||
localization | Cytoplasmic | ||||
score | 1.207 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.33 | ||||
4) Y-Loc Prediction |
|||||
localization | Nuclear | ||||
score | 99.91 | ||||
confidence value | 0.95 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | bHLH | ||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsOsbHLH010|OsMYL1 | ||||
Function assigned as per literature | Role in the inductive production of sakuranetin during defence responses in rice | ||||
Subcellular localization as per literature | OsMYL1 was localized along with OsMYC2 in the Nucleus | ||||
Cells used for localization experiment | onion epidermal cells | ||||
NUCLEAR or Not Nuclear | NUCLEAR | ||||
PMID | 28067270 | ||||
Reference of localization | https://www.nature.com/articles/srep40175 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 3 | ||||
Number of PAT7 | 1 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.123 | ||||
NLS score | 0.71 | ||||
Protein Sequence | >LOC_Os01g50940.1 protein MSWSETDAALFAAVLGHDAAHHLATTPPHLDAPEGSPSSAELQASLHDLVERQGGAWTYGIFWQESRGAGAASGRAARAVLGWGDGHCRDGAGHGEVGAA ERSVARKRVLLRLHALYGGGDEDGADYALRLDRVTGAEMYFLASMYFSFPEGSGGPGRALASGRHAWADVDPHPSGSGSAPGWYVRSSLAQSAGLRTVVF LPCKGGVLELGSVVAIRETPEVLRAIQSAMRAVPAPPEDFMRIFGKDLSPGRPSQPMGCDAPWTPRLVVQTTPVRPAKKEVVKAKPAEPPKSLDFSKANV QEQAGGQERRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPKISKMDKASLLSDAIAYIQELEARLRGDAPVPARADGPAVEVKAMQDEV VLRVTTPLDEHPISRVFHAMRESQISVVASDVAVSDDAVTHTLMVRSAGPERLTAETVLAAMSRGVSVTTPSP |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
6 |
|
||||
7 |
|
||||
Presence of Splice variants | No |