RGAP LOCUS ID | LOC_Os01g50770 | ||||
RAP-DB ID | Os01g0703600 | ||||
Function | adaptor complexes medium subunit family domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | cyto | ||||
score | 5 | ||||
2) CELLO Prediction |
|||||
localization | Golgi | ||||
score | 1.509 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.09 | ||||
4) Y-Loc Prediction |
|||||
localization | Cytoplasm | ||||
score | 99 | ||||
confidence value | 0.91 | ||||
Number Of Software Predicting Nucleus | 0 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | SPL28 | ||||
Function assigned as per literature | SPL28 appears to be involved in the regulation of vesicular trafficking, and SPL28 dysfunction causes the formation of hypersensitive response (HR)-like lesions, leading to the initiation of leaf senescence | ||||
Subcellular localization as per literature | golgi appartus | ||||
Cells used for localization experiment | onion epidermal cells | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 19825016 | ||||
Reference of localization | https://nph.onlinelibrary.wiley.com/doi/pdf/10.1111/j.1469-8137.2009.03047.x | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.128 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os01g50770.1 protein MAGAVSALFLLDIKGRVLVWRDYRGDVSALQAERFFTKLLDKEGDSEAHSPVVYDDAGVTYMFIQHNNVFLLTASRQNCNAASILLFLHRVVDVFKHYFE ELEEESLRDNFVVVYELLDEMMDFGYPQYTEAKILSEFIKTDAYRMEVSQRPPMAVTNAVSWRSEGIRYKKNEVFLDVVESVNILVNSNGQIVRSDVVGA LKMRTYLSGMPECKLGLNDRVLLEAQGRATKGKAIDLDDIKFHQCVRLARFENDRTISFIPPDGSFDLMTYRLSTQVKPLIWVEAQIEKHSRSRIELMVK ARSQFKERSTATNVEIEVPVPSDATNPNIRTSMGSAAYAPERDAMVWKVKSFPGGKDYMCRAEFSLPSITAEEAAPEKKAPIRVKFEIPYFTVSGIQVRY LKIIEKSGYQALPWVRYITMAGEYELRLI |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
4 |
|
||||
5 |
|
||||
Presence of Splice variants | YES |