LOC_Os01g36890
| RGAP LOCUS ID | LOC_Os01g36890 |
| RAP-DB ID | Os01g0549700 |
| Function | DEAD-box ATP-dependent RNA helicase, putative, expressed |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | cyto |
| score | 11 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 2.324 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.1 |
4) Y-Loc Prediction |
|
| localization | Cytoplasm |
| score | 90 |
| confidence value | 0.53 |
| Number Of Software Predicting Nucleus | 1 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsAIP1|OsBAT1 |
| Function assigned as per literature | OsAIP1 may play a role in tapetum degeneration during pollen development |
| Subcellular localization as per literature | Nucleus and cytoplasm, and localized in nuclei exclusively after formation of the API5-AIP1 complex |
| Cells used for localization experiment | Arabidopsis protoplasts |
| NUCLEAR or Not Nuclear | NUCLEAR |
| PMID | 21467577 |
| Reference of localization | http://www.plantcell.org/content/23/4/1416.long |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 1 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.134 |
| NLS score | -0.29 |
| Protein Sequence | >LOC_Os01g36890.2 protein MDVICQAKSGMGKTAVFVLSSLQQIDPVAGQVGALVLCHTRELAYQICHEFERFSKYLPEVKVAVFYGGVHIKKHKDLLKNDCPHIVVGTPGRILALARE KDLSLKNVRHFILDECDKMLDSLDMRRDVQEIFKMTPHDKQVMMFSATLSKEIRPVCKKFMQDPMEIYVDDEAKLTLHGLVQHYIKLSEAEKNRKLNDLL DALDFNQVVIFVKSVSRAAELNKLLCECNFPAISIHSGMTQEERLTRYKNFKEGHKRILVATDLVGRGIDIERVNIVINYDMPDSADSYLHRVGRAGRFG TKGLAITFVSSASDSDVLNQVQERFEVDIKELPEQIDTSTYMPS |
GO Analysis |
|
| Presence of Splice variants | No |