| RGAP LOCUS ID | LOC_Os01g24880 | ||||
| RAP-DB ID | Os01g0350900 | ||||
| Function | zinc finger, C3HC4 type domain containing protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 5 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 3.316 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.44 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 98.57 | ||||
| confidence value | 0.98 | ||||
| Number Of Software Predicting Nucleus | 3 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | IPI1 | ||||
| Function assigned as per literature | IPI1 affects plant architecture through precisely tuning IPA1 protein levels in different tissues in rice | ||||
| Subcellular localization as per literature | Nucleus when interacted with IPA1 | ||||
| Cells used for localization experiment | Rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 28298520 | ||||
| Reference of localization | http://www.plantcell.org/content/29/4/697.long | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.059 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os01g24880.1 protein MGAEEEEEPASAVGREGGGGGGGARAAGAGAGGDTADDDDSGESAAAVVPCSICLDAVVAGGGDRSTARLQCGHEFHLDCIGSAFNAKGVMQCPNCRQIE RGNWLYANGSRPSQDVSNDDWGHDEDFYDANQPETSRSVFLPFRFQWCPIGRLAQLPSVFDEGESAPPVTFHDFMGQNFTSEHLPVSAPGATPPGPYIAY FQPLQSSASSSSSHVTERTMDGTTYHDHWNPLPGPSDGRPLATVHPIDFHHNHWTHLPNSYSQPNSNNGVAEQMAIPVVPMRVGGLDSDSQQRGSLPSVY GNGSGSRSRIPSVPPMAPQFMRPHGNINEQYQQNSSSLYAAPQRRTAVQAVQDSMNFTLFPQAPTGPNSMETEDAGGNQFYAWERDRFAPYPLMPVDSEA NWWGSTPQSHGVTDHSAAPGRRLFGQWIGAGRSPPPPPPPPADNSSYRQMHIPRM |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | YES | ||||