 
    | RGAP LOCUS ID | LOC_Os01g12900 | ||||
| RAP-DB ID | Os01g0229400 | ||||
| Function | ras-related protein, putative, expressed | ||||
| Sub-cellular Localization Predictions | |||||
| 1) WoLF-PSORT Prediction | |||||
| localization | chlo | ||||
| score | 8 | ||||
| 2) CELLO Prediction | |||||
| localization | Nuclear | ||||
| score | 1.652 | ||||
| 3) NUCPRED Prediction | |||||
| localization | Non Nuclear | ||||
| score | 0.24 | ||||
| 4) Y-Loc Prediction | |||||
| localization | Cytoplasm | ||||
| score | 92 | ||||
| confidence value | 0.53 | ||||
| Number Of Software Predicting Nucleus | 1 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
| Experimental evidence for subcellular localization | |||||
| Published gene name (updated 1 January 2020) | OsRac1 | ||||
| Function assigned as per literature | OsRac1 has a general role in disease resistance of rice | ||||
| Subcellular localization as per literature | Plasma membrane | ||||
| Cells used for localization experiment | Rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 11149940 | ||||
| Reference of localization | http://www.pnas.org/content/98/2/759.short | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
| Sequence Analysis | |||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.173 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os01g12900.1 protein MPELRRFAPGVPVVLVGTKLDLREDRAYLADHPASSIITTEQGEELRKLIGAVAYIECSSKTQRNIKAVFDTAIKVVLQPPRHKDVTRKKLQSSSNRPVR RYFCGSACFA | ||||
| GO Analysis | |||||
| 1 | 
 | ||||
| 2 | 
 | ||||
| 3 | 
 | ||||
| 4 | 
 | ||||
| Presence of Splice variants | YES | ||||