RGAP LOCUS ID | LOC_Os01g10490 | ||||
RAP-DB ID | Os01g0201600 | ||||
Function | keratin, type I cytoskeletal 9, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | chlo | ||||
score | 7 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.753 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.12 | ||||
4) Y-Loc Prediction |
|||||
localization | Secreted pathw | ||||
score | |||||
confidence value | 0.96 | ||||
Number Of Software Predicting Nucleus | 1 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | OsGAE1 | ||||
Function assigned as per literature | OsGAE1 is involved in gibberellin-regulated growth and development of rice | ||||
Subcellular localization as per literature | Membrane fraction of plant cells | ||||
Cells used for localization experiment | Rice leaf sheath | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 16915516 | ||||
Reference of localization | https://link.springer.com/article/10.1007%2Fs11103-006-9030-1 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 0 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.053 | ||||
NLS score | -0.47 | ||||
Protein Sequence | >LOC_Os01g10490.1 protein MAAARMKNTTMGCAFLLAAFAMAAAFVPVAESRTTPVEKTTTTQAEDGVKKPDCVPAFDPRSFPGHGGTTTPTPIPGHHGGGGSSGTTPSHGGGPSGGAL PSPSHGGAAPSHGGGYGASPPVTPSPGGGYGGGSPAPSHGGGAYGSSPSTPSGGGSSPTPSHGGGAYGGGGAPATPASHDGHGLIPTTPGTCDYWRSHPM EMWSALGRWPSSVGHFFGSGSGGAGTGMSIQDALANTRGDGAGELMREGAAALLNSMTRSGFPYTAEQVRDAFAAAAGGGSDGAAAAQAAAFKKANEGGR A |
||||
GO Analysis |
|||||
1 |
|
||||
Presence of Splice variants | No |