LOC_Os01g10400
| RGAP LOCUS ID | LOC_Os01g10400 |
| RAP-DB ID | Os01g0200700 |
| Function | expressed protein |
Sub-cellular Localization Predictions |
|
1) WoLF-PSORT Prediction |
|
| localization | chlo |
| score | 9 |
2) CELLO Prediction |
|
| localization | Nuclear |
| score | 2.597 |
3) NUCPRED Prediction |
|
| localization | Non Nuclear |
| score | 0.54 |
4) Y-Loc Prediction |
|
| localization | Chloroplast |
| score | 9 |
| confidence value | 0.5 |
| Number Of Software Predicting Nucleus | 1 |
| Seed Specific | No |
| Transcription factor category | |
Experimental evidence for subcellular localization |
|
| Published gene name (updated 1 January 2020) | OsMTI-3a |
| Function assigned as per literature | |
| Subcellular localization as per literature | NA |
| Cells used for localization experiment | |
| NUCLEAR or Not Nuclear | |
| PMID | |
| Reference of localization | |
| Is Subcellular localization evidence by author available ? | No |
Sequence Analysis |
|
| Number of PAT4 | 1 |
| Number of PAT7 | 0 |
| Number of Bipartite | 0 |
| Basic residues % | 0.2 |
| NLS score | -0.16 |
| Protein Sequence | >LOC_Os01g10400.1 protein MMGSVAYTTTTIKKLHQKYFKINRKIVRTLHTRLDSSQQFLPDALIICLLCACVQPLRGGRRRRGERRLQVRHQLLLHRLQVRQVKSRSNRTLAAGESPT LISPQ |
GO Analysis |
|
| Presence of Splice variants | YES |