| RGAP LOCUS ID | LOC_Os01g09470 | ||||
| RAP-DB ID | Os01g0190500 | ||||
| Function | IQ calmodulin-binding motif family protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 13 | ||||
2) CELLO Prediction |
|||||
| localization | Nuclear | ||||
| score | 2.868 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.62 | ||||
4) Y-Loc Prediction |
|||||
| localization | Chloroplast | ||||
| score | 5 | ||||
| confidence value | 0.21 | ||||
| Number Of Software Predicting Nucleus | 2 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | GW5L | ||||
| Function assigned as per literature | GW5L acts as a negative regulator of both grain size and salt stress tolerance in rice | ||||
| Subcellular localization as per literature | Plasma membrane | ||||
| Cells used for localization experiment | Rice protoplasts | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 30450718 | ||||
| Reference of localization | https://onlinelibrary.wiley.com/doi/pdf/10.1111/jipb.12745 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 3 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.148 | ||||
| NLS score | 0.56 | ||||
| Protein Sequence | >LOC_Os01g09470.1 protein MGKAARWFRSLWGGGGGKKEQGREHGRTAAAPPPPDRKRWSFAKSSRDSTEGEAAAAVGGNAAIAKAAEAAWLKSMYSDTEREQSKHAIAVAAATAAAAD AAVAAAQAAVEVVRLTSQGPPTSSVFVCGGVLDPRGRAAAVKIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSMQALVRAQAAVRAARS SRGAALPPLHLHHHPPVRPRYSLQERYMDDTRSEHGVAAYSRRLSASIESSSYGYDRSPKIVEMDTGRPKSRSSSVRTSPPVVDAGAAEEWYANSVSSPL LPFHQLPGAPPRISAPSARHFPEYDWCPLEKPRPATAQSTPRLAHMPVTPTKSVCGGGGYGASPNCRGYMSSTQSSEAKVRSQSAPKQRPEPGVAGGTGG GARKRVPLSEVTLEARASLSGVGMQRSCNRVQEAFNFKTAVLSRFDRSSEPAAERDRDLFLQRRW |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | No | ||||