RGAP LOCUS ID | LOC_Os01g09470 | ||||
RAP-DB ID | Os01g0190500 | ||||
Function | IQ calmodulin-binding motif family protein, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
localization | Nuclear | ||||
score | 13 | ||||
2) CELLO Prediction |
|||||
localization | Nuclear | ||||
score | 2.868 | ||||
3) NUCPRED Prediction |
|||||
localization | Non Nuclear | ||||
score | 0.62 | ||||
4) Y-Loc Prediction |
|||||
localization | Chloroplast | ||||
score | 5 | ||||
confidence value | 0.21 | ||||
Number Of Software Predicting Nucleus | 2 | ||||
Seed Specific | No | ||||
Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
Published gene name (updated 1 January 2020) | GW5L | ||||
Function assigned as per literature | GW5L acts as a negative regulator of both grain size and salt stress tolerance in rice | ||||
Subcellular localization as per literature | Plasma membrane | ||||
Cells used for localization experiment | Rice protoplasts | ||||
NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
PMID | 30450718 | ||||
Reference of localization | https://onlinelibrary.wiley.com/doi/pdf/10.1111/jipb.12745 | ||||
Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
Number of PAT4 | 0 | ||||
Number of PAT7 | 3 | ||||
Number of Bipartite | 0 | ||||
Basic residues % | 0.148 | ||||
NLS score | 0.56 | ||||
Protein Sequence | >LOC_Os01g09470.1 protein MGKAARWFRSLWGGGGGKKEQGREHGRTAAAPPPPDRKRWSFAKSSRDSTEGEAAAAVGGNAAIAKAAEAAWLKSMYSDTEREQSKHAIAVAAATAAAAD AAVAAAQAAVEVVRLTSQGPPTSSVFVCGGVLDPRGRAAAVKIQTAFRGFLAKKALRALKALVKLQALVRGYLVRRQAAATLQSMQALVRAQAAVRAARS SRGAALPPLHLHHHPPVRPRYSLQERYMDDTRSEHGVAAYSRRLSASIESSSYGYDRSPKIVEMDTGRPKSRSSSVRTSPPVVDAGAAEEWYANSVSSPL LPFHQLPGAPPRISAPSARHFPEYDWCPLEKPRPATAQSTPRLAHMPVTPTKSVCGGGGYGASPNCRGYMSSTQSSEAKVRSQSAPKQRPEPGVAGGTGG GARKRVPLSEVTLEARASLSGVGMQRSCNRVQEAFNFKTAVLSRFDRSSEPAAERDRDLFLQRRW |
||||
GO Analysis |
|||||
1 |
|
||||
2 |
|
||||
3 |
|
||||
Presence of Splice variants | No |