| RGAP LOCUS ID | LOC_Os01g08320 | ||||
| RAP-DB ID | Os01g0178500 | ||||
| Function | OsIAA1 - Auxin-responsive Aux/IAA gene family member, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | Nuclear | ||||
| score | 9 | ||||
2) CELLO Prediction |
|||||
| localization | Chloroplast | ||||
| score | 2.325 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.31 | ||||
4) Y-Loc Prediction |
|||||
| localization | Nuclear | ||||
| score | 99.8 | ||||
| confidence value | 0.93 | ||||
| Number Of Software Predicting Nucleus | 2 | ||||
| Seed Specific | No | ||||
| Transcription factor category | AUX/IAA | ||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | OsIAA1 | ||||
| Function assigned as per literature | OsIAA1 play important roles in the cross-talk of auxin and brassinosteroid signaling pathways and plant morphogenesis | ||||
| Subcellular localization as per literature | Nucleus | ||||
| Cells used for localization experiment | onion epidermal cells | ||||
| NUCLEAR or Not Nuclear | NUCLEAR | ||||
| PMID | 19266169 | ||||
| Reference of localization | https://link.springer.com/article/10.1007/s11103-009-9474-1 | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 2 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.131 | ||||
| NLS score | 0.22 | ||||
| Protein Sequence | >LOC_Os01g08320.1 protein MSVETERSSTESSAASGLDFEDTALTLRLPGSLAAAAAPDPDRKRSSPSSSDAADAADNSSPLAAAADAPPAPKARVVGWPPVRSFRKNALAAKFVKVAV DGAPYLRKVDLEAYSGYDQLLRALQDKFFSHFTIRKFADDERKLVDAVNGTEYVPTYEDKDGDWMLVGDVPWKMFVETCQRLRLMKSSEAVNLAPRAAQ |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| 4 |
|
||||
| 5 |
|
||||
| Presence of Splice variants | No | ||||