| RGAP LOCUS ID | LOC_Os01g07880 | 
                        
                            | RAP-DB ID | Os01g0174000 | 
                        
                            | Function | transcription factor HY5, putative, expressed | 
                        
                            | Sub-cellular Localization
                                    Predictions | 
                        
                            | 1) WoLF-PSORT Prediction | 
                        
                            | localization | Nuclear | 
                        
                            | score | 14 | 
                        
                            | 2) CELLO
                                    Prediction | 
                        
                            | localization | Nuclear | 
                        
                            | score | 4.108 | 
                        
                            | 3) NUCPRED
                                    Prediction | 
                        
                            | localization | Non Nuclear | 
                        
                            | score | 0.71 | 
                        
                            | 4) Y-Loc
                                    Prediction | 
                        
                            | localization | Nuclear | 
                        
                            | score | 100 | 
                        
                            | confidence value | 1 | 
                        
                            | Number Of Software Predicting Nucleus | 3 | 
                        
                            | Seed Specific | No | 
                        
                            | Transcription factor category | bZIP | 
                        
                            | Experimental evidence for
                                    subcellular localization | 
                        
                            | Published gene name (updated 1 January 2020) | OsbZIP01 | 
                        
                            | Function assigned as per literature | A role in salicylic acid–dependent signal transduction pathway for defense of rice against pathogens | 
                        
                            | Subcellular localization as per literature | Nucleus | 
                        
                            | Cells used for localization experiment | onion epidermal cells | 
                        
                            | NUCLEAR or Not Nuclear | NUCLEAR | 
                        
                            | PMID | not available | 
                        
                            | Reference of localization | https://link.springer.com/article/10.1007/BF02772762 | 
                        
                            | Is Subcellular localization evidence by author available ? | No | 
                                                
                            | Sequence Analysis | 
                        
                            | Number of PAT4 | 0 | 
                        
                            | Number of PAT7 | 2 | 
                        
                            | Number of Bipartite | 3 | 
                        
                            | Basic residues % | 0.172 | 
                        
                            | NLS score | 1.78 | 
                        
                            | Protein Sequence | >LOC_Os01g07880.1 protein MAAQEQEQEKQQVKTSTTSSLPSSSERSSSSAPNNLKEGGGVESDEEIRRVPEMGGGGGSASSGAGADERQGKEDGKQQGGGGGGAAAAGGGQEQAPPAR
 KRGRSAGDKEQNRLKRLLRNRVSAQQARERKKAYMTELEAKAKDLELRNAELEQRVSTLQNENNTLRQILKNTTAHAGKRGGGGGGKGGDGGGGGKKHHF
 TKS
 | 
                        
                            | GO Analysis | 
                                                        
                                    | 1 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | signal transduction |  | 
                                                                
                                    | 2 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | response to abiotic stimulus |  | 
                                                                
                                    | 3 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | DNA binding |  | 
                                                                
                                    | 4 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | biosynthetic process |  | 
                                                                
                                    | 5 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | nucleobase, nucleoside, nucleotide and nucleic acid metabolic process |  | 
                                                                
                                    | 6 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | post-embryonic development |  | 
                                                                
                                    | 7 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | protein binding |  | 
                                                                
                                    | 8 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | cellular process |  | 
                                                                
                                    | 9 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | secondary metabolic process |  | 
                                                                
                                    | 10 | 
                                            
                                                | GO Category | Molecular Function |  
                                                | GO Term | sequence-specific DNA binding transcription factor activity |  | 
                                                                
                                    | 11 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | response to endogenous stimulus |  | 
                                                                
                                    | 12 | 
                                            
                                                | GO Category | Cellular comBiological Processonent |  
                                                | GO Term | nucleus |  | 
                                                                
                                    | 13 | 
                                            
                                                | GO Category | Biological Process |  
                                                | GO Term | biological_process |  | 
                                                        
                            | Presence of Splice variants | No |