| RGAP LOCUS ID | LOC_Os01g01340 | ||||
| RAP-DB ID | Os01g0102900 | ||||
| Function | light-induced protein 1-like, putative, expressed | ||||
Sub-cellular Localization Predictions |
|||||
1) WoLF-PSORT Prediction |
|||||
| localization | chlo | ||||
| score | 14 | ||||
2) CELLO Prediction |
|||||
| localization | Chloroplast | ||||
| score | 3.622 | ||||
3) NUCPRED Prediction |
|||||
| localization | Non Nuclear | ||||
| score | 0.02 | ||||
4) Y-Loc Prediction |
|||||
| localization | Secreted pathw | ||||
| score | |||||
| confidence value | 0.33 | ||||
| Number Of Software Predicting Nucleus | 0 | ||||
| Seed Specific | No | ||||
| Transcription factor category | |||||
Experimental evidence for subcellular localization |
|||||
| Published gene name (updated 1 January 2020) | Lir1|OsLIR1 | ||||
| Function assigned as per literature | LIR1 interacts with LEAF-TYPE FERREDOXIN-NADP(+) OXIDOREDUCTASE (LFNR), an essential chloroplast enzyme functioning in the last step of photosynthetic linear electron transfer | ||||
| Subcellular localization as per literature | Chloroplasts | ||||
| Cells used for localization experiment | tobacco cells | ||||
| NUCLEAR or Not Nuclear | NOT NUCLEAR | ||||
| PMID | 26941088 | ||||
| Reference of localization | http://www.plantcell.org/content/plantcell/28/3/712.full.pdf | ||||
| Is Subcellular localization evidence by author available ? | No | ||||
Sequence Analysis |
|||||
| Number of PAT4 | 0 | ||||
| Number of PAT7 | 0 | ||||
| Number of Bipartite | 0 | ||||
| Basic residues % | 0.078 | ||||
| NLS score | -0.47 | ||||
| Protein Sequence | >LOC_Os01g01340.1 protein MQTAASSVVGLSAVLPAAVKGRSLQIQAPRRVALRVRAAAAAVAVEAAEVDYSSNISVFPMEACDLIGGEACNVQMYPEAKLSSSAAVAVSRAAAEEVDR DYLSYDEPTTVFPEEACDDLGGEFCKAT |
||||
GO Analysis |
|||||
| 1 |
|
||||
| 2 |
|
||||
| 3 |
|
||||
| Presence of Splice variants | YES | ||||